• Home
  • Buyers
    • Register
    • Update
    • Free Sourcing Service
    • FAQ
  • Suppliers
    • Login/Register
    • Submit Products?
    • Membership Upgrade
    • FAQ
    • Information Service
  • Trade Leads
    • Message Search
    • Post New Message
    • Trade Leads Management
    • My Replied History
  • Support
    • Support Center
    • Contact Us
    • Link Exchange
  • 繁體中文網
  • 關於亞普達

  • Most Recent Recommendations
  • New Submitted
Click to select items, then click

Activated Carbon

To high-quality coconut shell, walnut shells, almond shells, peach shell as raw material, production technology refined by series, and the appearance is black granular. Advantage: developed pore structure, specific surface area, and strong adsorption properties, small negative force base layer, stable chemical performance, easy-renewable. Applicable to high-purity drinking water, industrial ...

Inquiry Now

ZHENGZHOU RONGDE WATER FILTER MATERIAL Co., Ltd

Categories:

Other Chemical Products,  Waste Water,  Chemical Compounds

IFNA21 Antibody FITC Conjugated

Description: Rabbit anti-human Interferon alpha-21 polyclonal Antibody;FITC conjugated Species reactivity: human Conjugate: FITC conjugated Tested applications: Immunogen: Recombinant human Interferon alpha-21 protein Details Parameters Code: CSB-PA011039EC01HU Alias: Interferon alpha-F IFNA21 ...

Inquiry Now

Flarebio Biotech Inc.

Categories:

Other Chemical Products

Mmp7|Mmp7 Antibody

Description: Rabbit anti-Rat Matrilysin polyclonal Antibody;Biotin conjugated Species reactivity: rat Conjugate: Biotin conjugated Tested applications: Immunogen: Recombinant Rat Matrilysin protein Code: CSB-PA014677ED01RA Alias: Matrin Matrix metalloproteinase-7 Pump-1 protease Uterine metalloproteinase Mmp7 Mmp-7 ...

Inquiry Now

Flarebio Biotech Inc.

Categories:

Other Chemical Products

Cinnamonitrile

【Main components】Cinnamonitrile 【Other name】(E) -3 - phenyl -2-acrylonitrile, Styryl nitrile, Beta- Triphenylacrylonitrile 【Products source】cinnamaldehyde, hydroxylamine hydrochloride 【Molecular weight】129.16 【Molecular formula】C9H10O 【Products content】97%,98% 【Appearance】 Light yellow transparent liquid ...

Inquiry Now

Wuhan Yuancheng Gongchuang Technology Co.Ltd

Categories:

Other Chemical Products

VCI Bags,Packing Bag,VCI Anticorrosion Bag

General: Rustoper (corrosion terminator) VCI Bag is made by processing high-quality VCI films as basic materials. VCI plastic film is the new generation of creative hi-tech products based on the combination of the high polymer material and VCI antirust technology. After the film is used to pack and seal the articles ...

Inquiry Now

Suzhou Rustop Protective Packaging Co,Ltd

Categories:

P.E. Bags,  Other Chemical Products

Natural Seaweed Extract Fucoidan

Characters White or slightly yellow powder Applications 1. Fucoidan can be used as raw material of medicine for kidney disease. It is very effective for renel failure in early and medium phase and is especially effective for improving kidney function and promoting kidneys clearance rate for creatinine. 2. Fucoidan can be used ...

Inquiry Now

Proxino Biology Co.,LTD

Categories:

Special Health Products,  Preservatives & Additives,  Chemical Compounds

N-Propyl Bromide, NPB, 1-bromopropane

Appearance:Colorless Transparent Liquid Main Content(%): ≥99.5 Iso-Propyl Bromide(%):≤0.01 Water Content(%):≤0.01 Non-Volatile Residue(%):≤0.001 Color(Hazen):≤10 ...

Inquiry Now

Weifang Moris Chemical Imp.&Exp. Co., Ltd

Categories:

Chemical Compounds,  Cleaning Products

RMaurocalcine

Sequence: gdclphlklc kenkdccskk ckrrgtniek rcr Description: Maurocalcine (MCa), is a peptidyl toxin originelly isolated from the venom of the scorpion Scorpio maurus palmatus. Native MCa is present at a low concentration in the venom (0.5% of total protein). This 33-mer basic peptide contains three disulfide bridges and has 82% sequence homology ...

Inquiry Now

Wuhan More Biotechnology Co.,Ltd.

Categories:

Other Chemical Products

RProTx-I

Sequence: ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS Description: Native ProTx-I has been isolated from the venom of the tarantula Thrixopelma pruriens. It was purified on the basis of its ability to reversibly inhibit the tetrodotoxin (TTX)-resistant Na channel Nav1.8. Structurally, ProTx-I is shown to belong to the inhibitory cystine knot (ICK) family of peptidyl toxins interacting ...

Inquiry Now

Wuhan More Biotechnology Co.,Ltd.

Categories:

Other Chemical Products

Power Plant Electrolyzer

Power Plant Electrolyzer for Power Stations, Desalination Plants, Coastal installations, Sewage treatment plants, Water Flood Systems Bio fouling, Cooling water systems Bio-fouling, Fire Water Systems Biofouling, Ballast water treatment System in Marine Vessels, Drinking water Plants, Swimming pool, Sea Water, Fresh Water, Offshore Treatment. Electro chlorination System Coastal installations: Electro ...

Inquiry Now

Ti Anode Fabricators Pvt. Ltd.

Categories:

Other Chemical Products

Hydrogenated Hydrocarbon Resin

GRETACK GM-100 is a water–white partially hydrogenated hydrocarbon resin with the characteristics of and narrow molecular weight distribution with excellent thermal stability, low odor, and water-soluble polymers like EVA, SIS, SBS, and APAO. It is primarily used in hot-melt adhesives (HMA), hot melt adhesives for hygiene products (HMPSA).. Key Characteristics: Colorless ...

Inquiry Now

GRESIN Chemical CO., LTD.

Categories:

Other Chemical Products,  Wear-Resistant Polymers

Glass Fiber Chopped Strand Mat

Glass Fiber Chopped Strand Mat Application Mainly used for tank, winding pipe products, the surface layer of the glass products. Can improve the surface corrosion resistance and enhance the comprehensive strength for finished fiber glass products, prevent leakage, prolong the service life. Need any help on silicone rubber, please feel free to contact Ms Vicky:   Tel:86-755-89212382 Mob/Whatsapp:86-18988789545 E-mail: hyz(at)szrl(dot)net    Skype:vicky921106 ...

Inquiry Now

Shenzhen vicky siliconeTechnology Co., Ltd

Categories:

Rubber Packing,  Rubber Mechanical Parts,  Other Chemical Products

Silicone Rubber For Tire Mold Making

Addition cure silicone rubber for tire mold making operation:   1. Pls clear the model and tool totally before operation to prevent cure inhibition. 2.Weigh the two part correctly by electronic weight in two separate container . 3. Mixing the two part in 1:1/10:1 and stir part A and part B evenly in 2-3 minutes . 4.And get the mixture for vacuum-pumping for de-air the bubble in around 2-3 minutes . (If there is no vacuum machine, pls pour the mixture carefully and slowly down the side of the mold frame so that less bubbles caused) 5. Enclose the product (the original model) with four plastic plates or wooden plates. 6. Clean your products and brush a layer of release agent(detergent or soap water)  on your product. Need any help on silicone rubber, please feel free to contact Ms Vicky:   Tel:86-755-89212382 Mob/Whatsapp:86-18988789545 E-mail: hyz(at)szrl(dot)net    Skype:vicky921106 ...

Inquiry Now

Shenzhen vicky siliconeTechnology Co., Ltd

Categories:

Rubber Mechanical Parts,  Chemical Compounds,  Rubber Products for Vehicle

Potassium Hydroxide /potassa (KOH)

Potassium Hydroxide /potassa (KOH) Specifications: CAS No.: 1310-58-3 EINECS No.:215-181-3 Description: white flakes. It is one of the strongest alkalis. Flake is able to react quickly with moisture liberating heat. Purity:90% Application: used in alkaline batteries industry, soaps, high-class detergents and cosmetics industry, medicine intermediate, potassium chemicals, synthetic ruber, ABS resin, food additive, dyestuffs, ...

Inquiry Now

Xuzhou Honglian Chemicals Co., ltd

Categories:

Other Chemical Products

Formic Acid (Methanoic Acid)

Specifications: CAS No.: 64-18-6 Description: colorless fuming inflammable liquid with strong irritating odor; soluble in water, ethanol and ether; slightly soluble in benzene. Purity: 85% 90% Application: Used in pharmaceutical, pesticide, leather, textile, rubber, paper, food, and poultry industries etc. Packaging: 25KG HDPE DRUM 20MT/20FCL, or at client’s request. Delivery: Within 15days Item Index Extra best Best quality First quality Appearance colorless transparent liquid without suspension Assay, ...

Inquiry Now

Xuzhou Honglian Chemicals Co., ltd

Categories:

Other Chemical Products

  • 1

Hot Products

Metal Pressing

Hp Air Spray Gun

Hp Air Spray Gun

Kr857m Reduced Pressure Spray Gun

Need sourcing assistance?

Tell us what you are looking for, and we will search for you.

Apply Now

Related Keywords

  • 1-bromo-3-chloropropane
  • Activated Carbon
  • C5 hydrocarbon resin
  • C9 hydrocarbon resin
  • Customized peptide
  • Electrolyzer for electrochlorinator
  • Fucoidan
  • Gene engineering
  • Industrial Enzyme
  • Ion Channel.
  • N-propyl bromide
  • RTV-2 molding silicone
  • Recombinant proteins
  • VCI antirust film
  • Water treatment Chemicals
  • antibody gene protein kit
  • desiccant
  • dioxide
  • hexabromocyclododecane
  • hydrogenated hydrocarbon
  • inorganic chemical
  • masterbatch
  • pigment
  • Buyer Service

    • Register
    • Free Sourcing Service
    • FAQ
  • Supplier Service

    • Login/Register
    • Membership Upgrade
    • FAQ
    • Information Service
  • Trade Leads

    • Message Search
    • Post New Message
    • Trade Leads Management
    • My Replied History
  • Support

    • Support Center
    • Contact Us
    • Link Exchange
  • Home
  • Hot Search
  • Trade Leads
  • Press Rrelease
  • Submit Products™
  • RSS
  • About Us
  • Link Exchange
  • Legal Policy
  • Privacy Policy
  • Register
  • User Guide
Copyright © 1996-2016 All Products Online Corp. All rights reserved